PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00056.1_g00041.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 252aa    MW: 27658.4 Da    PI: 7.5837
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00056.1_g00041.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.42.8e-3740100262
                   zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                              ++++lkcprC+s ntkfCyynny+ sqPr+fCk+CrryWtkGG lrnvPvGgg+r  k+s+
  Rsa1.0_00056.1_g00041.1  40 HHQSLKCPRCNSLNTKFCYYNNYNHSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRTAKRSK 100
                              57899***************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-333198IPR003851Zinc finger, Dof-type
PfamPF027013.2E-324298IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.7054498IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104682IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MQDIHDYSMT GSGGGGGGST VRFLGGDRRM RVHQNNILNH HQSLKCPRCN SLNTKFCYYN  60
NYNHSQPRHF CKSCRRYWTK GGVLRNVPVG GGCRTAKRSK SKQPPSSSLS TADKPTTAQD  120
GEEKPSSSET SSLTASTSTA VTAKVTSDMY NLKLYGNGIE WSTLLGQGSS DGMGGFIETT  180
PFEFGGNTVH QQLEDRTALV DPSMGFEPLD WGSGGGDQTL FDLTSTVDNA HWSHQDQHDF  240
YLPQFSDRFS SF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3531381e-85AK353138.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-17-G03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013654643.11e-121PREDICTED: dof zinc finger protein DOF5.4-like
SwissprotQ8LDR01e-100DOF54_ARATH; Dof zinc finger protein DOF5.4
TrEMBLA0A078DFK01e-121A0A078DFK0_BRANA; BnaC09g05040D protein
TrEMBLA0A0D3E1N31e-121A0A0D3E1N3_BRAOL; Uncharacterized protein
STRINGBra035956.1-P1e-118(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44822656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.17e-92OBF binding protein 4